PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G355100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 575aa    MW: 62914.1 Da    PI: 4.5178
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G355100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM90.33.4e-283244532128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknra.....tksgyWkat 86 
                          pG+rF+Ptdee++  yL++k +g+++++ ++++++++++ +P++ ++++    +  wy Fs+rd+ky++gkr+ r+      k gyWk+ 
  Brast02G355100.1.p 324 LPGVRFQPTDEEII-GYLRRKYDGRRMPA-DIVRDFNVFQDHPSTVKENFGDsIDGAWYVFSPRDRKYSQGKRPDRSvvkgnHKIGYWKSN 412
                         59************.9*************.99**************96554414459*******************6355544589***** PP

                 NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          k++++ + +g+l+g  + L+f  g++p+g+ t W ++eyr+
  Brast02G355100.1.p 413 TKEESISV-DGKLIGSVNNLTFELGDQPHGKPTAWKIKEYRI 453
                         *******9.99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100531.876323494IPR003441NAC domain
SuperFamilySSF1019413.01E-30324494IPR003441NAC domain
PfamPF023659.1E-16325453IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MAGTRSDAAD LSGHGQPGAP LPPPLASSSS PLPPPPSSSQ QPAFPSSMAW APSPWQQPAG  60
ASASFWHDPW QPQQHDAIAP DFESSGQFDD AIFLDPMFRD LLPPEQPGIP QQHDAFLTPE  120
YLGSYDHLDE PSFFRAMADE LEQPPFAPQP GITQMQQPDA QTTPFFSNHQ MEPGAPAMAM  180
PMQGLTDQNG YYWGQGPLHW QPSAAAAEAP AVHAAPPLAY APPPADPPKP PTGRRPRGRP  240
RGSTAAKSRS KAKAKAKPKP KLATTAATAT PEPCHEHPMS SEQEQPAAAG AVAGEEEEAV  300
GGTSGQGAQQ QEEDEAVEYA DTNLPGVRFQ PTDEEIIGYL RRKYDGRRMP ADIVRDFNVF  360
QDHPSTVKEN FGDSIDGAWY VFSPRDRKYS QGKRPDRSVV KGNHKIGYWK SNTKEESISV  420
DGKLIGSVNN LTFELGDQPH GKPTAWKIKE YRIPGFQRLL GPKLTPKKGH PKQQNLDPHP  480
VTLDDWVIYK LFYKEKKAKQ GVPVDVEDQQ DVEVGEDADK KVDVEDQHDV EVAEDVDEEA  540
DVGEDADEED DDKHDNTSDG NPPSDGHDDY FTYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-2232550019171NAC domain-containing protein 19
4dul_A2e-2232550019171NAC domain-containing protein 19
1ut7_B2e-2232550019171NO APICAL MERISTEM PROTEIN
1ut7_A2e-2232550019171NO APICAL MERISTEM PROTEIN
1ut4_B2e-2232550019171NO APICAL MERISTEM PROTEIN
1ut4_A2e-2232550019171NO APICAL MERISTEM PROTEIN
3swp_D2e-2232550022174NAC domain-containing protein 19
3swp_C2e-2232550022174NAC domain-containing protein 19
3swp_B2e-2232550022174NAC domain-containing protein 19
3swp_A2e-2232550022174NAC domain-containing protein 19
3swm_D2e-2232550022174NAC domain-containing protein 19
3swm_C2e-2232550022174NAC domain-containing protein 19
3swm_B2e-2232550022174NAC domain-containing protein 19
3swm_A2e-2232550022174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229598.22e-85PREDICTED: uncharacterized protein LOC104582026
RefseqXP_014753160.12e-85PREDICTED: uncharacterized protein LOC104582026
TrEMBLA0A0Q3KUZ12e-85A0A0Q3KUZ1_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131302130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.15e-24Arabidopsis NAC domain containing protein 26